30-MINUTE MEALS! Get the email series now
Royal Recipe

Pea and Mint Soup

5 from 1 vote
1 Comments
Emily Carter
By: Emily CarterUpdated: Jul 22, 2026
This post may contain affiliate links. Please read our disclosure policy.

A bright, silky pea and mint soup that's ready in 20 minutes — perfect served hot or chilled. Fresh flavors, simple technique, and weeknight-friendly.

Pea and Mint Soup

This vibrant pea and mint soup has been one of my quickest, most reliable ways to brighten a weeknight. I discovered this combination on a sunlit spring afternoon when my fridge held only frozen peas and a small bunch of mint; the result was unexpectedly fragrant and luxuriously smooth. It quickly became a staple when I wanted something light but fancy enough for guests. The sweetness of the peas, the cool lift from mint, and a touch of cream balance into a soup that can be served steaming or chilled for picnic-friendly fare.

What I love most is how forgiving the method is: whether you start with fresh, shelling peas on the counter as you chat with family, or use frozen peas straight from the bag, the technique is the same. Texture is the key here — aim for a velvety puree and adjust the cream to make the mouthfeel richer or lighter. Every time I make this, someone asks for seconds and jars of leftover soup disappear within a day. It’s the kind of small-ceremony recipe that turns a simple lunch into something remembered.

Why You'll Love This Recipe

  • Fast: Ready in just 20 minutes from start to finish, ideal for busy weeknights or last-minute starters.
  • Minimal ingredients: Uses pantry and fridge staples — peas, onion, a splash of cream, and a few mint leaves.
  • Flexible serving: Equally delicious hot or chilled; make it in advance and refrigerate or serve over ice for a refreshing starter.
  • Accessible technique: No special skills required — simmer and blend; a sieve is optional for an ultra-silky finish.
  • Kid-friendly and crowd-pleasing: The natural sweetness of peas converts picky eaters; garnish choices let you dress it up for company.
  • Light but satisfying: Moderate calories with good protein from peas, makes a great starter or a light lunch paired with bread.

In my kitchen this soup became the go-to when friends popped by unexpectedly — I could toss everything in a pan, blend, and plate within minutes. My partner loves it chilled on a summer afternoon, while my parents prefer it warm with a splash more cream and a dusting of Espelette pepper.

Ingredients

  • Peas: 1 7/8 cups (about 10.6 oz) fresh or frozen peas — frozen are excellent year-round and give a bright green color. Use organic if you prefer, and if using fresh, shell them the same day for the sweetest flavor.
  • Onion: 1 small onion (about 3 oz), roughly chopped — I like a sweet yellow onion for gentle aromatics; red will add a sharper bite and more color.
  • Olive oil: 1 teaspoon extra-virgin olive oil — just enough to soften the onion and add a silky coating to the peas as they simmer.
  • Water: 1 2/3 cups (about 13.5 fl oz) salted water — this is the cooking liquid; use vegetable stock for deeper flavor.
  • Mint: 5 fresh mint leaves — bruised lightly to release oils; spearmint or a mild garden mint works best (avoid peppermint, which is too intense).
  • Cream: 2 tablespoons heavy cream — adds richness and silk; for a lighter version use 2 tablespoons half-and-half or plain yogurt stirred in after blending.
  • Espelette pepper: A pinch — a smoky, mildly spicy pepper that complements the sweetness of peas; cayenne or black pepper are acceptable substitutes.
  • Salt and pepper: To taste; start with 1/4 teaspoon salt and adjust after blending.

Instructions

Prepare the peas and aromatics: Shell fresh peas if needed or measure frozen peas. Roughly chop the small onion so it breaks down quickly while simmering. Add peas and onion to a medium saucepan with 1 teaspoon olive oil and 1 2/3 cups salted water. The oil helps carry flavor and prevents sticking. Simmer: Bring the liquid to a gentle simmer over medium heat. Once simmering, adjust to maintain a light bubble and cook for 10 minutes — this softens peas and mellows the onion. Watch for vigorous boiling, which can leach color and flavor; a gentle simmer preserves the bright green hue. Add mint and season: Tear the 5 mint leaves and add them to the pan with a pinch of Espelette pepper. The short infusion time keeps the mint fresh rather than grassy. Taste the broth and add more salt if needed — seasoning before blending ensures even flavor. Blend until silky: Transfer the contents to a blender or use an immersion blender in the saucepan. Blend on high until very smooth, 30–60 seconds. For the silkiest texture, pass through a fine sieve back into the pan, pressing with a spatula to extract every drop. Return to low heat if serving warm. Finish with cream and adjust: Stir in 2 tablespoons cream and a final pinch of pepper. Warm gently for a minute — avoid boiling after adding cream. If serving chilled, cool quickly by placing the pot in an ice bath, then refrigerate. Adjust seasoning before serving. User provided content image 2

You Must Know

  • High in plant protein: peas are a good source of protein and fiber compared with many vegetables; one serving offers a satisfying nutrient profile.
  • Make-ahead friendly: soup holds in the refrigerator for up to 3 days and freezes well for 2–3 months in an airtight container.
  • Texture matters: for the creamiest mouthfeel, strain through a fine mesh sieve; skip this for a rustic, thicker bowl.
  • Temperature options: serve hot as a comforting starter or chilled on ice for a refreshing summer course.

My favorite thing about this soup is how it bridges seasons: chilled and bright for picnics, and comforting and fragrant when warmed on a cool evening. Friends often comment on the color before they taste it, and that moment of surprise — how something so simple can taste so refined — is why I keep this recipe in rotation.

User provided content image 1

Storage Tips

Cool the soup to room temperature before refrigerating. Store in airtight containers for up to 3 days; glass jars with tight lids are ideal for preserving color and aroma. For longer storage, freeze in portion-sized containers, leaving 1/2 inch headspace for expansion. Thaw overnight in the refrigerator and reheat gently over low heat, stirring frequently — vigorous boiling after freezing can cause slight separation; whisk in a splash of water or extra cream to reincorporate.

Ingredient Substitutions

If you don’t have heavy cream, stir in 2 tablespoons of Greek yogurt after the soup has cooled slightly; temper the yogurt by whisking in a spoonful of warm soup first to avoid curdling. Vegetable stock can replace water for deeper flavor — use 1 2/3 cups stock and reduce added salt. For a dairy-free version, substitute 2 tablespoons canned coconut milk (full fat) for the cream; expect a slightly coconut-forward note that pairs well with mint. Fresh chives or a small handful of basil can replace mint for a different herbaceous edge.

Serving Suggestions

Serve in warmed bowls with a drizzle of olive oil or a small spoonful of crème fraîche for an elegant finish. Garnish with a sprig of mint, toasted pumpkin seeds, or a scattering of crumbled feta for salt and tang. Pair with crusty country bread or a warm goat cheese tartine for a light lunch. For a composed starter, ladle into shallow bowls, top with a small quenelle of herb ricotta, and sprinkle Espelette pepper for visual contrast.

Cultural Background

Pea soups have long been part of European culinary traditions, from rustic split-pea stews to refined purées seen in French bistros. The addition of mint is a classic technique across Mediterranean and French cuisine: the herb cuts through sweetness and adds a fresh, aromatic note. This version leans on the French preference for velouté-like textures — smooth, gently seasoned, and finished with a touch of cream for elegance.

Seasonal Adaptations

In spring, use freshly shelled peas and the first tender mint leaves for the most vibrant flavor. In late summer or autumn, a splash of lemon zest brightens the bowl when fresh peas are less available. For holiday meals, dress this up with a swirl of brown butter and toasted hazelnuts to introduce a toasty, festive component.

Meal Prep Tips

Double the batch and freeze individual portions for quick lunches. When prepping for the week, store garnishes separately: keep seeds, herbs, and cream in small containers so the soup stays fresh and vibrant. Reheat gently on the stove or in the microwave, stirring halfway through. If the texture thickens after refrigeration, whisk in a tablespoon or two of warm water to loosen before serving.

Whether you make it for a casual family dinner or a small dinner party, this pea and mint soup rewards simple ingredients with approachable technique. I hope it becomes one of the recipes you rely on when you want fast, fresh flavor with a touch of finesse.

Pro Tips

  • Use frozen peas for consistent color and sweetness when fresh peas are out of season.

  • Pass blended soup through a fine mesh sieve for the silkiest texture; press with a spatula to extract maximum flavor.

  • To chill quickly for serving cold, place the blender pitcher in an ice bath for a few minutes before refrigerating.

  • Adjust cream at the end — start with 2 tablespoons and increase if you prefer a richer mouthfeel.

This nourishing pea and mint soup recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Appetizers & Snackssouprecipepeamintfrenchvegetarianweeknight
No ratings yet

Pea and Mint Soup

This Pea and Mint Soup recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 2 steaks
Pea and Mint Soup
Prep:10 minutes
Cook:10 minutes
Rest Time:10 mins
Total:20 minutes

Ingredients

Produce

Pantry

Dairy

Instructions

1

Prepare peas and onion

Shell fresh peas if using. Roughly chop the small onion. Place peas and onion in a medium saucepan with 1 teaspoon olive oil and 1 2/3 cups salted water (or stock).

2

Simmer gently

Bring to a gentle simmer over medium heat, then reduce to maintain a light bubble. Cook for 10 minutes until peas are tender but still bright green.

3

Add mint and season

Add torn mint leaves and a pinch of Espelette pepper. Taste and adjust salt as needed before blending to ensure even seasoning.

4

Blend until smooth

Blend the mixture until completely smooth using a blender or immersion blender. For a silkier texture, pass through a fine mesh sieve and return to the pan.

5

Finish and serve

Stir in 2 tablespoons heavy cream and a final pinch of pepper. Warm gently for a minute if serving hot, or chill quickly in an ice bath and refrigerate if serving cold.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 211.5kcal | Carbohydrates: 26g | Protein:
8.3g | Fat: 8.35g | Saturated Fat: 3g |
Polyunsaturated Fat: 2g | Monounsaturated Fat:
3g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@kitchenfunwithmy3sons on social media!

Pea and Mint Soup

Categories:

Pea and Mint Soup

Did You Make This?

Leave a comment & rating below or tag @kitchenfunwithmysons on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm Emily!

Chef and recipe creator specializing in delicious Appetizers & Snacks cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

Get My 30-Minute Meals email series!

Quick and easy dinner ideas delivered to your inbox.